PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA07G23980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 571aa    MW: 60484 Da    PI: 5.2629
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA07G23980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.44.2e-15114174363
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a+lk+++
  ONIVA07G23980.1 114 EAKRRARLVRNRESAHQSRQRKKQYVEELEGKVKVMQATIADLTARISCVTAENAALKQQL 174
                      78********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-14112176IPR004827Basic-leucine zipper domain
PfamPF001701.6E-13114174IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.484114177IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-13116174No hitNo description
Gene3DG3DSA:1.20.5.1703.9E-17116175No hitNo description
CDDcd147046.91E-22117168No hitNo description
PROSITE patternPS000360120134IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MAEPDLLAPF ADLPFPPGDD FPDFPTLGDD AFALEDFDLD DLDLDFDVDL FPPDAPPPVT  60
TSSSSSAAGS PEAGTSSAGD GGSKNEESAD SSSPSRSESD GGGGGSGKDG KDDEAKRRAR  120
LVRNRESAHQ SRQRKKQYVE ELEGKVKVMQ ATIADLTARI SCVTAENAAL KQQLSGTAGA  180
DAAAPPPPMP MYPAVYPLPM PWIHPAYAMR GSQVPLVPIP RLKTQLPAST PEPPAKKARK  240
TKKVAGVSLL GLLFLMMVCG CLVPAVNRMY GAAYTGEGAA IVPSHHGRIL AVEGPQNSVS  300
NGVDPKVPQN GSETLPALLY LPRNGKHVKI NGNLVIKSIV ASEKASSRLS NYGGKGSGNQ  360
EKEETSLAIP GYVAPLEAGE VMDSAKGMNE LMALAPGDGS IYREDDGMLP QWFSEAMSGP  420
MLNSGMCTEV FQFDLSPTTA DANGIVPVYS GSVTNTSQNY TENLPSGPVQ KVKNRRISYS  480
EAIPLRGSIS NDTDHFKAPP KNHSQSHAGR KPVSSVVVSV LADPREESDR DGEGRISSNS  540
LSRIFVVVLI DSVKYVTYSC VLPFKSHSPH L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218980.0AK121898.1 Oryza sativa Japonica Group cDNA clone:J033105F09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647746.10.0PREDICTED: bZIP transcription factor 17
TrEMBLA0A0E0I4U40.0A0A0E0I4U4_ORYNI; Uncharacterized protein
STRINGBGIOSGA026248-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.13e-77bZIP family protein